Protein Info for Rv0931c in Mycobacterium tuberculosis H37Rv

Annotation: Transmembrane serine/threonine-protein kinase D PknD (protein kinase D) (STPK D)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 transmembrane" amino acids 379 to 402 (24 residues), see Phobius details PF00069: Pkinase" amino acids 15 to 262 (248 residues), 150.9 bits, see alignment E=2.1e-47 PF07714: PK_Tyr_Ser-Thr" amino acids 17 to 261 (245 residues), 97.8 bits, see alignment E=3.1e-31 PF06293: Kdo" amino acids 97 to 158 (62 residues), 21.8 bits, see alignment E=4.9e-08 PF01436: NHL" amino acids 468 to 489 (22 residues), 20.4 bits, see alignment (E = 1.8e-07) amino acids 509 to 535 (27 residues), 33 bits, see alignment (E = 1.8e-11) amino acids 551 to 577 (27 residues), 31.9 bits, see alignment (E = 4.2e-11) amino acids 596 to 619 (24 residues), 20.3 bits, see alignment (E = 1.9e-07) amino acids 635 to 661 (27 residues), 21 bits, see alignment (E = 1.2e-07)

Best Hits

Swiss-Prot: 100% identical to PKND_MYCTU: Serine/threonine-protein kinase PknD (pknD) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K08884, serine/threonine protein kinase, bacterial [EC: 2.7.11.1] (inferred from 100% identity to mtf:TBFG_10949)

Predicted SEED Role

"Serine/threonine-protein kinase PknD (EC 2.7.11.1)" (EC 2.7.11.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (664 amino acids)

>Rv0931c Transmembrane serine/threonine-protein kinase D PknD (protein kinase D) (STPK D) (Mycobacterium tuberculosis H37Rv)
VSDAVPQVGSQFGPYQLLRLLGRGGMGEVYEAEDTRKHRVVALKLISPQYSDNAVFRARM
QREADTAGRLTEPHIVPIHDYGEINGQFFVEMRMIDGTSLRALLKQYGPLTPARAVAIVR
QIAAALDAAHANGVTHRDVKPENILVTASDFAYLVDFGIARAASDPGLTQTGTAVGTYNY
MAPERFTGDEVTYRADIYALACVLGECLTGAPPYRADSVERLIAAHLMDPAPQPSQLRPG
RVPPALDQVIAKGMAKNPAERFMSAGDLAIAAHDALTTSEQHQATTILRRGDNATLLATP
ADTGLSQSESGIAGAGTGPPTPGAARWSPGDSATVAGPLAADSRGGNWPSQTGHSPAVPN
ALQASLGHAVPPAGNKRKVWAVVGAAAIVLVAIVAAAGYLVLRPSWSPTQASGQTVLPFT
GIDFRLSPSGVAVDSAGNVYVTSEGMYGRVVKLATGSTGTTVLPFNGLYQPQGLAVDGAG
TVYVTDFNNRVVTLAAGSNNQTVLPFDGLNYPEGLAVDTQGAVYVADRGNNRVVKLAAGS
KTQTVLPFTGLNDPDGVAVDNSGNVYVTDTDNNRVVKLEAESNNQVVLPFTDITAPWGIA
VDEAGTVYVTEHNTNQVVKLLAGSTTSTVLPFTGLNTPLAVAVDSDRTVYVADRGNDRVV
KLTS