Protein Info for Rv0930 in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphate-transport integral membrane ABC transporter PstA1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 31 to 297 (267 residues), 258.9 bits, see alignment E=2.3e-81 PF00528: BPD_transp_1" amino acids 103 to 303 (201 residues), 68.6 bits, see alignment E=3e-23

Best Hits

Swiss-Prot: 100% identical to PSTA1_MYCTU: Phosphate transport system permease protein PstA 1 (pstA1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to mtu:Rv0930)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>Rv0930 Probable phosphate-transport integral membrane ABC transporter PstA1 (Mycobacterium tuberculosis H37Rv)
VSPSMSIEALDQPVKPVVFRPLTLRRRIKNSVATTFFFTSFVVALIPLVWLLWVVIARGW
FAVTRSGWWTHSLRGVLPEQFAGGVYHALYGTLVQAGVAAVLAVPLGLMTAVYLVEYGTG
RMSRVTTFTVDVLAGVPSIVAALFVFSLWIATLGFQQSAFAVALALVLLMLPVVVRAGEE
MLRLVPDELREASYALGVPKWKTIVRIVAPIAMPGIVSGILLSIARVVGETAPVLVLVGY
SHSINLDVFHGNMASLPLLIYTELTNPEHAGFLRVWGAALTLIIVVATINLAAAMIRFVA
TRRRRLPL