Protein Info for Rv0929 in Mycobacterium tuberculosis H37Rv

Annotation: Phosphate-transport integral membrane ABC transporter PstC2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 23 to 318 (296 residues), 308.8 bits, see alignment E=1.6e-96 PF00528: BPD_transp_1" amino acids 104 to 317 (214 residues), 54.3 bits, see alignment E=7.4e-19

Best Hits

Swiss-Prot: 100% identical to PSTC2_MYCBO: Phosphate transport system permease protein PstC 2 (pstC2) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to mtf:TBFG_10947)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>Rv0929 Phosphate-transport integral membrane ABC transporter PstC2 (Mycobacterium tuberculosis H37Rv)
VVTEPLTKPALVAVDMRPARRGERLFKLAASAAGSTIVIAILLIAIFLLVRAVPSLRANH
ANFFTSTQFDTSDDEQLAFGVRDLFMVTALSSITALVLAVPVAVGIAVFLTHYAPRRLSR
PFGAMVDLLAAVPSIIFGLWGIFVLAPKLEPIARFLNRNLGWLFLFKQGNVSLAGGGTIF
TAGIVLSVMILPIVTSISREVFRQTPLIQIEAALALGATKWEVVRMTVLPYGRSGVVAAS
MLGLGRALGETVAVLVILRSAARPGTWSLFDGGYTFASKIASAASEFSEPLPTGAYISAG
FALFVLTFLVNAAARAIAGGKVNG