Protein Info for Rv0916c in Mycobacterium tuberculosis H37Rv

Annotation: PE family protein PE7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00934: PE" amino acids 4 to 94 (91 residues), 87.5 bits, see alignment E=3e-29

Best Hits

Swiss-Prot: 53% identical to PE13_MYCTU: PE family protein PE13 (PE13) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_0923)

Predicted SEED Role

"PE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (99 amino acids)

>Rv0916c PE family protein PE7 (Mycobacterium tuberculosis H37Rv)
MSFVTIQPVVLAAATGDLPTIGTAVSARNTAVCAPTTGVLPPAANDVSVLTAARFTAHTK
HYRVVSKPAALVHGMFVALPAATADAYATTEAVNVVATG