Protein Info for Rv0908 in Mycobacterium tuberculosis H37Rv

Annotation: Probable metal cation transporter ATPase P-type CtpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 797 transmembrane" amino acids 50 to 79 (30 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 601 to 621 (21 residues), see Phobius details amino acids 633 to 653 (21 residues), see Phobius details amino acids 670 to 690 (21 residues), see Phobius details amino acids 703 to 722 (20 residues), see Phobius details amino acids 729 to 749 (21 residues), see Phobius details amino acids 762 to 784 (23 residues), see Phobius details TIGR01494: HAD ATPase, P-type, family IC" amino acids 73 to 319 (247 residues), 104.5 bits, see alignment E=2.3e-34 amino acids 508 to 611 (104 residues), 86.3 bits, see alignment E=7.7e-29 PF00122: E1-E2_ATPase" amino acids 104 to 196 (93 residues), 82.9 bits, see alignment E=1.9e-27 PF00702: Hydrolase" amino acids 295 to 548 (254 residues), 60.1 bits, see alignment E=6.2e-20 PF08282: Hydrolase_3" amino acids 520 to 571 (52 residues), 23 bits, see alignment 9.2e-09

Best Hits

Swiss-Prot: 100% identical to CTPE_MYCBO: Calcium-transporting ATPase CtpE (ctpE) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K12952, cation-transporting ATPase E [EC: 3.6.3.-] (inferred from 100% identity to mra:MRA_0915)

Predicted SEED Role

"Cation-transporting ATPase, E1-E2 family"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (797 amino acids)

>Rv0908 Probable metal cation transporter ATPase P-type CtpE (Mycobacterium tuberculosis H37Rv)
MTRSASATAGLTDAEVAQRVAEGKSNDIPERVTRTVGQIVRANVFTRINAILGVLLLIVL
ATGSLINGMFGLLIIANSVIGMVQEIRAKQTLDKLAIIGQAKPLVRRQSGTRTRSTNEVV
LDDIIELGPGDQVVVDGEVVEEENLEIDESLLTGEADPIAKDAGDTVMSGSFVVSGAGAY
RATKVGSEAYAAKLAAEASKFTLVKSELRNGINRILQFITYLLVPAGLLTIYTQLFTTHV
GWRESVLRMVGALVPMVPEGLVLMTSIAFAVGVVRLGQRQCLVQELPAIEGLARVDVVCA
DKTGTLTESGMRVCEVEELDGAGRQESVADVLAALAAADARPNASMQAIAEAFHSPPGWV
VAANAPFKSATKWSGVSFRDHGNWVIGAPDVLLDPASVAARQAERIGAQGLRVLLLAAGS
VAVDHAQAPGQVTPVALVVLEQKVRPDARETLDYFAVQNVSVKVISGDNAVSVGAVADRL
GLHGEAMDARALPTGREELADTLDSYTSFGRVRPDQKRAIVHALQSHGHTVAMTGDGVND
VLALKDADIGVAMGSGSPASRAVAQIVLLNNRFATLPHVVGEGRRVIGNIERVANLFLTK
TVYSVLLALLVGIECLIAIPLRRDPLLFPFQPIHVTIAAWFTIGIPAFILSLAPNNERAY
PGFVRRVMTSAVPFGLVIGVATFVTYLAAYQGRYASWQEQEQASTAALITLLMTALWVLA
VIARPYQWWRLALVLASGLAYVVIFSLPLAREKFLLDASNLATTSIALAVGVVGAATIEA
MWWIRSRMLGVKPRVWR