Protein Info for Rv0895 in Mycobacterium tuberculosis H37Rv

Annotation: Possible triacylglycerol synthase (diacylglycerol acyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 384 to 403 (20 residues), see Phobius details TIGR02946: acyltransferase, WS/DGAT/MGAT" amino acids 32 to 488 (457 residues), 511 bits, see alignment E=1.6e-157 PF03007: WS_DGAT_cat" amino acids 32 to 296 (265 residues), 316.8 bits, see alignment E=1.5e-98 PF06974: WS_DGAT_C" amino acids 341 to 486 (146 residues), 105.3 bits, see alignment E=3e-34

Best Hits

Swiss-Prot: 100% identical to Y895_MYCTO: Putative diacyglycerol O-acyltransferase MT0919 (MT0919) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10914)

Predicted SEED Role

"Wax ester synthase/acyl-CoA:diacylglycerol acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>Rv0895 Possible triacylglycerol synthase (diacylglycerol acyltransferase) (Mycobacterium tuberculosis H37Rv)
VRQQQEADVVALGRKPGLLCVPERFRAMDLPMAAADALFLWAETPTRPLHVGALAVLSQP
DNGTGRYLRKVFSAAVARQQVAPWWRRRPHRSLTSLGQWSWRTETEVDLDYHVRLSALPP
RAGTAELWALVSELHAGMLDRSRPLWQVDLIEGLPGGRCAVYVKVHHALADGVSVMRLLQ
RIVTADPHQRQMPTLWEVPAQASVAKHTAPRGSSRPLTLAKGVLGQARGVPGMVRVVADT
TWRAAQCRSGPLTLAAPHTPLNEPIAGARSVAGCSFPIERLRQVAEHADATINDVVLAMC
GGALRAYLISRGALPGAPLIAMVPVSLRDTAVIDVFGQGPGNKIGTLMCSLATHLASPVE
RLSAIRASMRDGKAAIAGRSRNQALAMSALGAAPLALAMALGRVPAPLRPPNVTISNVPG
PQGALYWNGARLDALYLLSAPVDGAALNITCSGTNEQITFGLTGCRRAVPALSILTDQLA
HELELLVGVSEAGPGTRLRRIAGRR