Protein Info for Rv0892 in Mycobacterium tuberculosis H37Rv

Annotation: Probable monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 7 to 204 (198 residues), 47.7 bits, see alignment E=6.6e-16 PF00743: FMO-like" amino acids 8 to 337 (330 residues), 74.2 bits, see alignment E=3.6e-24 PF13450: NAD_binding_8" amino acids 10 to 77 (68 residues), 47.6 bits, see alignment E=7.3e-16 PF13738: Pyr_redox_3" amino acids 10 to 206 (197 residues), 52.5 bits, see alignment E=2.1e-17

Best Hits

Swiss-Prot: 100% identical to Y916_MYCBO: Uncharacterized monooxygenase Mb0916 (BQ2027_MB0916) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00492, [EC: 1.14.13.-] (inferred from 100% identity to mtu:Rv0892)

Predicted SEED Role

"Cyclohexanone monooxygenase (EC 1.14.13.22)" (EC 1.14.13.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-, 1.14.13.22

Use Curated BLAST to search for 1.14.13.- or 1.14.13.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>Rv0892 Probable monooxygenase (Mycobacterium tuberculosis H37Rv)
MTGRCPTVAVVGAGMSGMCVAITLLSAGITDVCIYEKADDVGGTWRDNTYPGLTCDVPSR
LYQYSFAKNPNWTQMFSRGGEIQDYLRGIAERYGLRHRIRFGATVVSARFDDGRWVLRTD
SGTESTVDFLISATGVLHHPRIPPIAGLDDFRGTVFHSARWDHTVPLLGRRIAVIGTGST
GVQLVCGLAGVAGKVTMFQRTAQWVLPWPNPRYSKLARVFHRAFPCLGSLAYKAYSLSFE
TFAVALSNPGLHRKLVGAVCRASLRRVRDPRLRRALTPDYEPMCKRLVMSGGFYRAIQRD
DVELVTAGIDHVEHRGIVTDDGVLHEVDVIVLATGFDSHAFFRPMQLTGRDGIRIDDVWQ
DGPHAHQTVAIPGFPNFFMMLGPHSPVGNFPLTAVAESQAEHIVQWIKRWRHGEFDTMEP
KSAATEAYNTVLRAAMPNTVWTTGCDSWYLNKDGIPEVWPFAPAKHRAMLANLHPEEYDL
RRYAAVRATSRPQSA