Protein Info for Rv0885 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 98 to 107 (10 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details PF11583: AurF" amino acids 20 to 303 (284 residues), 370.3 bits, see alignment E=3.1e-115

Best Hits

Swiss-Prot: 100% identical to Y885_MYCTU: Uncharacterized protein Rv0885 (Rv0885) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_0907)

Predicted SEED Role

"possible transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>Rv0885 Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MDRTRIVRRWRRNMDVADDAEYVEMLATLSEGSVRRNFNPYTDIDWESPEFAVTDNDPRW
ILPATDPLGRHPWYQAQSRERQIEIGMWRQANVAKVGLHFESILIRGLMNYTFWMPNGSP
EYRYCLHESVEECNHTMMFQEMVNRVGADVPGLPRRLRWVSPLVPLVAGPLPVAFFIGVL
AGEEPIDHTQKNVLREGKSLHPIMERVMSIHVAEEARHISFAHEYLRKRLPRLTRMQRFW
ISLYFPLTMRSLCNAIVVPPKAFWEEFDIPREVKKELFFGSPESRKWLCDMFADARMLAH
DTGLMNPIARLVWRLCKIDGKPSRYRSEPQRQHLAAAPAA