Protein Info for Rv0846c in Mycobacterium tuberculosis H37Rv

Annotation: Probable oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details PF07732: Cu-oxidase_3" amino acids 83 to 182 (100 residues), 91.3 bits, see alignment E=7.1e-30 PF07731: Cu-oxidase_2" amino acids 94 to 180 (87 residues), 22.9 bits, see alignment E=9.5e-09 amino acids 389 to 500 (112 residues), 101.6 bits, see alignment E=4.8e-33 PF00394: Cu-oxidase" amino acids 190 to 347 (158 residues), 84.7 bits, see alignment E=1.2e-27

Best Hits

Swiss-Prot: 100% identical to MMCO_MYCTU: Multicopper oxidase MmcO (mmcO) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mbo:Mb0869c)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>Rv0846c Probable oxidase (Mycobacterium tuberculosis H37Rv)
MPELATSGNAFDKRRFSRRGFLGAGIASGFALAACASKPTASGAAGMTAAIDAAEAARPH
SGRTVTATLTPQPARIDLGGPIVSTLTYGNTIPGPLIRATVGDEIVVSVTNRLGDPTSVH
WHGIALRNDMDGTEPATANIGPGGDFTYRFSVPDPGTYWAHPHVGLQGDHGLYLPVVVDD
PTEPGHYDAEWIIILDDWTDGIGKSPQQLYGELTDPNKPTMQNTTGMPEGEGVDSNLLGG
DGGDIAYPYYLINGRIPVAATSFKAKPGQRIRIRIINSAADTAFRIALAGHSMTVTHTDG
YPVIPTEVDALLIGMAERYDVMVTAAGGVFPLVALAEGKNALARALLSTGAGSPPDPQFR
PDELNWRVGTVEMFTAATTANLGRPEPTHDLPVTLGGTMAKYDWTINGEPYSTTNPLHVR
LGQRPTLMFDNTTMMYHPIHLHGHTFQMIKADGSPGARKDTVIVLPKQKMRAVLVADNPG
VWVMHCHNNYHQVAGMATRLDYIL