Protein Info for Rv0827c in Mycobacterium tuberculosis H37Rv

Annotation: Metal sensor transcriptional regulator KmtR (ArsR-SmtB family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF12840: HTH_20" amino acids 25 to 74 (50 residues), 38.6 bits, see alignment E=1.7e-13 PF01022: HTH_5" amino acids 27 to 72 (46 residues), 50.2 bits, see alignment E=3.8e-17 PF12802: MarR_2" amino acids 29 to 77 (49 residues), 28 bits, see alignment E=4e-10 PF09339: HTH_IclR" amino acids 38 to 74 (37 residues), 23.3 bits, see alignment E=8.8e-09

Best Hits

Swiss-Prot: 100% identical to KMTR_MYCTU: HTH-type transcriptional regulator KmtR (kmtR) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10842)

Predicted SEED Role

"transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>Rv0827c Metal sensor transcriptional regulator KmtR (ArsR-SmtB family) (Mycobacterium tuberculosis H37Rv)
MYADSGPDPLPDDQVCLVVEVFRMLADATRVQVLWSLADREMSVNELAEQVGKPAPSVSQ
HLAKLRMARLVRTRRDGTTIFYRLENEHVRQLVIDAVFNAEHAGPGIPRHHRAAGGLQSV
AKASATKDVG