Protein Info for Rv0819 in Mycobacterium tuberculosis H37Rv

Annotation: GCN5-related N-acetyltransferase, MshD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR03448: mycothiol synthase" amino acids 5 to 308 (304 residues), 427.1 bits, see alignment E=1.8e-132 PF00583: Acetyltransf_1" amino acids 46 to 111 (66 residues), 29.4 bits, see alignment E=1.8e-10 amino acids 196 to 299 (104 residues), 29.3 bits, see alignment E=1.9e-10 PF13508: Acetyltransf_7" amino acids 48 to 109 (62 residues), 27.6 bits, see alignment E=6.3e-10

Best Hits

Swiss-Prot: 100% identical to MSHD_MYCTA: Mycothiol acetyltransferase (mshD) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_0841)

MetaCyc: 100% identical to mycothiol synthase (Mycobacterium tuberculosis H37Rv)
RXN1G-4 [EC: 2.3.1.189]

Predicted SEED Role

"Acetyl-CoA:Cys-GlcN-Ins acetyltransferase, mycothiol synthase MshD" in subsystem Glutathione analogs: mycothiol

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.189

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>Rv0819 GCN5-related N-acetyltransferase, MshD (Mycobacterium tuberculosis H37Rv)
VTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLRELGQQRTEHLLVAGSRPGGP
IIGYLNLSPPRGAGGAMAELVVHPQSRRRGIGTAMARAALAKTAGRNQFWAHGTLDPARA
TASALGLVGVRELIQMRRPLRDIPEPTIPDGVVIRTYAGTSDDAELLRVNNAAFAGHPEQ
GGWTAVQLAERRGEAWFDPDGLILAFGDSPRERPGRLLGFHWTKVHPDHPGLGEVYVLGV
DPAAQRRGLGQMLTSIGIVSLARRLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFT
TYSVDTAYALAGTDN