Protein Info for Rv0818 in Mycobacterium tuberculosis H37Rv

Annotation: Transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21695: GlnR_1st
  • amino acids 3 to 111 (109 residues), 144.4 bits, E=1.3e-46
• PF00486: Trans_reg_C
  • amino acids 145 to 218 (74 residues), 98.8 bits, E=1.6e-32

Best Hits

Swiss-Prot: 62% identical to GLNR_STRCO: Transcriptional regulatory protein GlnR (glnR) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_0840)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Protein Sequence (255 amino acids)

>Rv0818 Transcriptional regulatory protein (Mycobacterium tuberculosis H37Rv)
LLELLLLTSELYPDPVLPALSLLPHTVRTAPAEASSLLEAGNADAVLVDARNDLSSGRGL
CRLLSSTGRSIPVLAVVSEGGLVAVSADWGLDEILLLSTGPAEIDARLRLVVGRRGDLAD
QESLGKVSLGELVIDEGTYTARLRGRPLDLTYKEFELLKYLAQHAGRVFTRAQLLHEVWG
YDFFGGTRTVDVHVRRLRAKLGPEHEALIGTVRNVGYKAVRPARGRPPAADPDDEDADPG
RDGMQEPLVDPLRSQ