Protein Info for Rv0796 in Mycobacterium tuberculosis H37Rv

Annotation: Putative transposase for insertion sequence element IS6110

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 159 to 177 (19 residues), see Phobius details PF13276: HTH_21" amino acids 75 to 128 (54 residues), 62.4 bits, see alignment 5.9e-21 PF00665: rve" amino acids 153 to 255 (103 residues), 89 bits, see alignment E=3.4e-29 PF13683: rve_3" amino acids 245 to 311 (67 residues), 45.2 bits, see alignment E=8.9e-16

Best Hits

Swiss-Prot: 100% identical to TRA9_MYCTA: Putative transposase for insertion sequence element IS986/IS6110 (MRA_0011) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K07497, putative transposase (inferred from 100% identity to mtu:Rv3475)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>Rv0796 Putative transposase for insertion sequence element IS6110 (Mycobacterium tuberculosis H37Rv)
KDRVGFLRGRARPASTLITRFIADHQGHREGPDGLRWGVESICTQLTELGVPIAPSTYYD
HINREPSRRELRDGELKEHISRVHAANYGVYGARKVWLTLNREGIEVARCTVERLMTKLG
LSGTTRGKARRTTIADPATARPADLVQRRFGPPAPNRLWVADLTYVSTWAGFAYVAFVTD
AYARRILGWRVASTMATSMVLDAIEQAIWTRQQEGVLDLKDVIHHTDRGSQYTSIRFSER
LAEAGIQPSVGAVGSSYDNALAETINGLYKTELIKPGKPWRSIEDVELATARWVDWFNHR
RLYQYCGDVPPVELEAAYYAQRQRPAAG