Protein Info for Rv0794c in Mycobacterium tuberculosis H37Rv

Annotation: Probable oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 22 to 338 (317 residues), 158.1 bits, E=8.7e-50
• PF00070: Pyr_redox
  • amino acids 193 to 258 (66 residues), 43.8 bits, E=7.7e-15
• PF02852: Pyr_redox_dim
  • amino acids 377 to 483 (107 residues), 71.1 bits, E=2.1e-23

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to mtb:TBMG_00810)

Predicted SEED Role

"PF00070 family, FAD-dependent NAD(P)-disulphide oxidoreductase" in subsystem Mercuric reductase

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Protein Sequence (499 amino acids)

>Rv0794c Probable oxidoreductase (Mycobacterium tuberculosis H37Rv)
MTAAQQDQAPMATPGCREGETYDVVVLGAGPVGQNVADRARAGGLRVAVVERELVGGECS
YWACVPSKALLRPVIAISDARRVDGAREAVDGSINTAGVFGRRNRYVAHWDDTGQADWVS
GIGATLIRGDGRLDGPRRVVVTKSSGESVALTARHAVVICTGSRPALPDLPGITEARPWT
NRQATDNSTVPDRLAIVGAGGVGVEMATAWQGLGASVTLLARGSGLLPRMEPFVGELIGR
GLADAGVDVRVGVSVRALGRPNPTGPVVLELDDGTELRVDEVLFATGRAPRTDDIGLETI
GLTPGSWLDVDDTCRVRAVDDGWLYAAGDVNHRALLTHQGKYQARIAGTAIGARAAGRPL
DTTSWGMHATTADHHAVPQAFFTDPEAAAVGLTADQAAQAGHRIKAIDVEIGDVVMGAKL
FADGYTGRARMVVDVDRGHLLGVTMVGPGAAELLHSATVAVAGQVPIDRLWHAVPCFPTI
SELWLRLLESYRDSFYLLV