Protein Info for Rv0791c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF00296: Bac_luciferase" amino acids 22 to 277 (256 residues), 165.3 bits, see alignment E=1.2e-52 TIGR03619: probable F420-dependent oxidoreductase, Rv2161c family" amino acids 31 to 319 (289 residues), 181.9 bits, see alignment E=7.9e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00807)

Predicted SEED Role

"Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>Rv0791c Conserved protein (Mycobacterium tuberculosis H37Rv)
MNAKDDPHFGLMLAATVNGLAVGSYREMVVVSQTAEEYGFDSVWLCDHFLTISPGEYAKV
AGIAADTGSATGTETGGAGQCAPSRSLPLLECWTALAALSRDTTKLRLGTSVLCNSYRHP
SVLAKMAATLDVISQGRLDLGLGAGWFRRESQAYGIPFPPVGDRVSALAESLQVIKAVWT
EPNPTYAGRFYTLDGATCDPPPVQRPHPPLWIGGEGDRVQRIAAKHAQGLNVRWWSPQQV
TQRRGFLTQASEAAGRDPDTLRLSVTLLLAPTQSGEEEVRIREEFASIPEPGLIVGTPDR
CVERIREYQDRGVGHFLFTIPHVVKSDYLHIIGSDIIPRVKTEVTIP