Protein Info for Rv0788 in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphoribosylformylglycinamidine synthase I PURG (FGAM synthase I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13507: GATase_5
  • amino acids 3 to 204 (202 residues), 124 bits, E=1.2e-39
• TIGR01737: phosphoribosylformylglycinamidine synthase I
  • amino acids 4 to 219 (216 residues), 266.9 bits, E=6.3e-84
• PF00117: GATase
  • amino acids 20 to 96 (77 residues), 25.5 bits, E=1.9e-09
• PF07685: GATase_3
  • amino acids 25 to 95 (71 residues), 34.4 bits, E=3.7e-12
• PF01965: DJ-1_PfpI
  • amino acids 36 to 101 (66 residues), 28 bits, E=3.7e-10

Best Hits

Swiss-Prot: 100% identical to PURQ_MYCTO: Phosphoribosylformylglycinamidine synthase subunit PurQ (purQ) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 100% identity to mtb:TBMG_00804)

MetaCyc: 47% identical to phosphoribosylformylglycinamidine synthetase subunit I (Bacillus subtilis subtilis 168)
Phosphoribosylformylglycinamidine synthase. [EC: 6.3.5.3]

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Protein Sequence (224 amino acids)

>Rv0788 Probable phosphoribosylformylglycinamidine synthase I PURG (FGAM synthase I) (Mycobacterium tuberculosis H37Rv)
VTARIGVVTFPGTLDDVDAARAARQVGAEVVSLWHADADLKGVDAVVVPGGFSYGDYLRA
GAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRV
ASTSTAWTSRFEPDADLLVPLKSGEGRYVAPEKVLDELEGEGRVVFRYHDNVNGSLRDIA
GICSANGRVVGLMPHPEHAIEALTGPSDDGLGLFYSALDAVLTG