Protein Info for Rv0783c in Mycobacterium tuberculosis H37Rv

Annotation: Possible multidrug resistance integral membrane efflux protein EmrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 395 to 417 (23 residues), see Phobius details amino acids 437 to 455 (19 residues), see Phobius details amino acids 503 to 525 (23 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 43 to 525 (483 residues), 633.7 bits, see alignment E=1.1e-194 PF07690: MFS_1" amino acids 50 to 444 (395 residues), 183.2 bits, see alignment E=3.4e-58

Best Hits

Swiss-Prot: 100% identical to EMRB_MYCTU: Multidrug resistance protein B homolog (emrB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtc:MT0807)

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>Rv0783c Possible multidrug resistance integral membrane efflux protein EmrB (Mycobacterium tuberculosis H37Rv)
MLGNAMVEACPAEGDAPVPITPAGRPRSGQRSYPDRLDVGLLRTAGVCVLASVMAHVDVT
VVSVAQRTFVADFGSTQAVVAWTMTGYMLALATVIPTAGWAADRFGTRRLFMGSVLAFTL
GSLLCAVAPNILLLIIFRVVQGFGGGMLTPVSFAILAREAGPKRLGRVMAVVGIPMLLGP
VGGPILGGWLIGAYGWRWIFLVNLPVGLSALVLAAIVFPRDRPAASENFDYMGLLLLSPG
LATFLFGVSSSPARGTMADRHVLIPAITGLALIAAFVAHSWYRTEHPLIDMRLFQNRAVA
QANMTMTVLSLGLFGSFLLLPSYLQQVLHQSPMQSGVHIIPQGLGAMLAMPIAGAMMDRR
GPAKIVLVGIMLIAAGLGTFAFGVARQADYLPILPTGLAIMGMGMGCSMMPLSGAAVQTL
APHQIARGSTLISVNQQVGGSIGTALMSVLLTYQFNHSEIIATAKKVALTPESGAGRGAA
VDPSSLPRQTNFAAQLLHDLSHAYAVVFVIATALVVSTLIPAAFLPKQQASHRRAPLLSA