Protein Info for Rv0780 in Mycobacterium tuberculosis H37Rv

Annotation: Phosphoribosylaminoimidazole-succinocarboxamide synthase PurC (SAICAR synthetase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00081: phosphoribosylaminoimidazolesuccinocarboxamide synthase
  • amino acids 10 to 286 (277 residues), 228.7 bits, E=4.8e-72
• PF01259: SAICAR_synt
  • amino acids 11 to 260 (250 residues), 245.4 bits, E=3.4e-77

Best Hits

Swiss-Prot: 100% identical to PUR7_MYCBT: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 100% identity to mra:MRA_0789)

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Protein Sequence (297 amino acids)

>Rv0780 Phosphoribosylaminoimidazole-succinocarboxamide synthase PurC (SAICAR synthetase) (Mycobacterium tuberculosis H37Rv)
MRPALSDYQHVASGKVREIYRVDDEHLLLVASDRISAYDYVLDSTIPDKGRVLTAMSAFF
FGLVDAPNHLAGPPDDPRIPDEVLGRALVVRRLEMLPVECVARGYLTGSGLLDYQATGKV
CGIALPPGLVEASRFATPLFTPATKAALGDHDENISFDRVVEMVGALRANQLRDRTLQTY
VQAADHALTRGIIIADTKFEFGIDRHGNLLLADEIFTPDSSRYWPADDYRAGVVQTSFDK
QFVRSWLTGSESGWDRGSDRPPPPLPEHIVEATRARYINAYERISELKFDDWIGPGA