Protein Info for Rv0734 in Mycobacterium tuberculosis H37Rv

Annotation: Methionine aminopeptidase MapA (map) (peptidase M) (MetAP)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details TIGR00500: methionine aminopeptidase, type I" amino acids 17 to 264 (248 residues), 260.3 bits, see alignment E=9.1e-82 PF00557: Peptidase_M24" amino acids 23 to 257 (235 residues), 139.6 bits, see alignment E=6.4e-45

Best Hits

Swiss-Prot: 100% identical to MAP11_MYCTU: Methionine aminopeptidase 1 (map-1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to mbb:BCG_0784)

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>Rv0734 Methionine aminopeptidase MapA (map) (peptidase M) (MetAP) (Mycobacterium tuberculosis H37Rv)
MRPLARLRGRRVVPQRSAGELDAMAAAGAVVAAALRAIRAAAAPGTSSLSLDEIAESVIR
ESGATPSFLGYHGYPASICASINDRVVHGIPSTAEVLAPGDLVSIDCGAVLDGWHGDAAI
TFGVGALSDADEALSEATRESLQAGIAAMVVGNRLTDVAHAIETGTRAAELRYGRSFGIV
AGYGGHGIGRQMHMDPFLPNEGAPGRGPLLAAGSVLAIEPMLTLGTTKTVVLDDKWTVTT
ADGSRAAHWEHTVAVTDDGPRILTLG