Protein Info for Rv0733 in Mycobacterium tuberculosis H37Rv

Annotation: Adenylate kinase Adk (ATP-AMP transphosphorylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13238: AAA_18
  • amino acids 3 to 132 (130 residues), 35.3 bits, E=3.1e-12
• PF13671: AAA_33
  • amino acids 3 to 142 (140 residues), 39 bits, E=2e-13
• PF00406: ADK
  • amino acids 5 to 158 (154 residues), 180.2 bits, E=5.9e-57
• PF13207: AAA_17
  • amino acids 6 to 137 (132 residues), 108.4 bits, E=7.2e-35

Best Hits

Swiss-Prot: 99% identical to KAD_MYCBP: Adenylate kinase (adk) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 99% identity to mtc:MT0757)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.3

Protein Sequence (181 amino acids)

>Rv0733 Adenylate kinase Adk (ATP-AMP transphosphorylase) (Mycobacterium tuberculosis H37Rv)
VRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVP
SDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVL
LERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALG
K