Protein Info for Rv0732 in Mycobacterium tuberculosis H37Rv

Annotation: Probable preprotein translocase SecY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 18 to 35 (18 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details TIGR00967: preprotein translocase, SecY subunit" amino acids 15 to 436 (422 residues), 425.3 bits, see alignment E=1.3e-131 PF00344: SecY" amino acids 75 to 424 (350 residues), 371.2 bits, see alignment E=2.3e-115

Best Hits

Swiss-Prot: 100% identical to SECY_MYCBO: Protein translocase subunit SecY (secY) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K03076, preprotein translocase subunit SecY (inferred from 100% identity to mtf:TBFG_10746)

Predicted SEED Role

"Preprotein translocase secY subunit (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>Rv0732 Probable preprotein translocase SecY (Mycobacterium tuberculosis H37Rv)
VLSAFISSLRTVDLRRKILFTLGIVILYRVGAALPSPGVNFPNVQQCIKEASAGEAGQIY
SLINLFSGGALLKLTVFAVGVMPYITASIIVQLLTVVIPRFEELRKEGQAGQSKMTQYTR
YLAIALAILQATSIVALAANGGLLQGCSLDIIADQSIFTLVVIVLVMTGGAALVMWMGEL
ITERGIGNGMSLLIFVGIAARIPAEGQSILESRGGVVFTAVCAAALIIIVGVVFVEQGQR
RIPVQYAKRMVGRRMYGGTSTYLPLKVNQAGVIPVIFASSLIYIPHLITQLIRSGSGVVG
NSWWDKFVGTYLSDPSNLVYIGIYFGLIIFFTYFYVSITFNPDERADEMKKFGGFIPGIR
PGRPTADYLRYVLSRITLPGSIYLGVIAVLPNLFLQIGAGGTVQNLPFGGTAVLIMIGVG
LDTVKQIESQLMQRNYEGFLK