Protein Info for Rv0729 in Mycobacterium tuberculosis H37Rv

Annotation: Possible D-xylulose kinase XylB (xylulokinase) (xylulose kinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00370: FGGY_N" amino acids 7 to 104 (98 residues), 34.9 bits, see alignment E=1.3e-12 PF02782: FGGY_C" amino acids 291 to 402 (112 residues), 84.1 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: K00854, xylulokinase [EC: 2.7.1.17] (inferred from 99% identity to mbt:JTY_0749)

Predicted SEED Role

"Putative xylulose kinase (EC 2.7.1.17)" in subsystem Xylose utilization (EC 2.7.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>Rv0729 Possible D-xylulose kinase XylB (xylulokinase) (xylulose kinase) (Mycobacterium tuberculosis H37Rv)
VSRDDVTIGIDIGTTAVKAVAADDNGRVTARVRIGHQLAVPAPDRLEHDADEAWRRGPLA
ALDRLVGPDTRALAVAAMVPSLTAVDPAGRPITPGLLYGDARGRVPNASVARAQSVPSVG
ETAEFLRWTAGQALDASGYWPAPAVANYALSGEAVIDYATAVTTLPLFDGTGWNATACAD
CGVTVDRMPRVETFGVGVGQVRGTGAVLAVGAVDALCEQIVAGADRDGDVLVLCGATLIV
WTTISAARQVPGLWTIPHTAPGKSQIGGASNAGGLFLNWVDRVIGPGDPALADPRRVPVW
LPYIRGERTPFHEPDRRAVLDGVDLSQDAASVRRAAYEASGFVVRQLIELSGAPVARIVA
AGGGTRIQPWMQAIADATGRPVEVSRVAEGAALGAAFLGRLAAGLESSIADAARWASTDR
IVEPSADWAGPTKERYRRFLALSGSKLA