Protein Info for Rv0725c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00027: methyltransferase, TIGR00027 family" amino acids 17 to 193 (177 residues), 218 bits, see alignment E=7.7e-69 PF04072: LCM" amino acids 19 to 193 (175 residues), 225.1 bits, see alignment E=3.3e-71

Best Hits

Swiss-Prot: 100% identical to Y733_MYCTA: Putative S-adenosyl-L-methionine-dependent methyltransferase MRA_0733 (MRA_0733) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_03997)

Predicted SEED Role

"FIG00819993: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>Rv0725c Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MPRAHDDNWDLASSVGATATMVAAGRALATKDPRGLINDPFAEPLVRAVGLDFFTKLIDG
ELDIATTGNLSPGRAQAMIDGIAVRTKYFDDYFRTATDGGVRQVVILAAGLDARAYRLPW
PAGTVVYEIDQPQVIDFKTTTLAGIGAKPTAIRRTVYIDLRADWPAALQAAGLDSTAPTA
WLAEGMLIYLPPDPRTGCSTTAPNSVLRAARSLPNLSRALWISTQAGYEKWRIRFASTAW
TSTWRRWCIPANAATSSTTCAPRAGTLRAQCGPTYSGAMVCPFPPHTTTIRSAKSSSSAV
V