Protein Info for Rv0721 in Mycobacterium tuberculosis H37Rv

Annotation: 30S ribosomal protein S5 RpsE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 TIGR01021: ribosomal protein uS5" amino acids 40 to 194 (155 residues), 229.6 bits, see alignment E=7.6e-73 PF00333: Ribosomal_S5" amino acids 44 to 106 (63 residues), 96.9 bits, see alignment E=5.4e-32 PF03719: Ribosomal_S5_C" amino acids 119 to 188 (70 residues), 97.4 bits, see alignment E=2.6e-32

Best Hits

Swiss-Prot: 100% identical to RS5_MYCBP: 30S ribosomal protein S5 (rpsE) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 100% identity to mtf:TBFG_10735)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>Rv0721 30S ribosomal protein S5 RpsE (Mycobacterium tuberculosis H37Rv)
MAEQPAGQAGTTDNRDARGDREGRRRDSGRGSRERDGEKSNYLERVVAINRVSKVVKGGR
RFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEARKSFFRVPLIGGTITHPVQGEA
AAGVVLLRPASPGTGVIAGGAARAVLECAGVHDILAKSLGSDNAINVVHATVAALKLLQR
PEEVAARRGLPIEDVAPAGMLKARRKSEALAASVLPDRTI