Protein Info for Rv0713 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 222 to 246 (25 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details PF14494: DUF4436" amino acids 58 to 311 (254 residues), 351.2 bits, see alignment E=1.5e-109

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_0763)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>Rv0713 Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MAGSDPPTGGPASQAGSDAGASPEHKHMSRRKHLVLDVCIILGVLIAYVFSLLGYDWLAH
TPGPLPQPDVGTTDDTVVLIRFEELHTVANRLDVKVLVLPDDSMIDHRLQVLTTDTSVRL
YPENELGDLQYPVGKLPAQVATTIEAHGNPGAWPFDTYTTDTVQADVLVGAGDNRQYVPA
RVEVTGSLEGWDISAVRVGESSQTSDRPDNVIITLKRAKGPLVFDLGICLVLITLPTLAL
FVAIQMITGRRKFQPPFGTWYAAMLFAVVPLRTILPGSPPAGAWIDRAVVIWVLIALAAA
MVVYIVAWYRESD