Protein Info for Rv0696 in Mycobacterium tuberculosis H37Rv

Annotation: Probable membrane sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 322 to 345 (24 residues), see Phobius details TIGR03965: mycofactocin system glycosyltransferase" amino acids 12 to 469 (458 residues), 600.3 bits, see alignment E=1.4e-184 PF13641: Glyco_tranf_2_3" amino acids 82 to 290 (209 residues), 40.1 bits, see alignment E=8.9e-14 PF00535: Glycos_transf_2" amino acids 85 to 241 (157 residues), 91.4 bits, see alignment E=1.6e-29 PF10111: Glyco_tranf_2_2" amino acids 86 to 297 (212 residues), 49.3 bits, see alignment E=1.3e-16 PF13632: Glyco_trans_2_3" amino acids 159 to 331 (173 residues), 48.5 bits, see alignment E=2.5e-16

Best Hits

Swiss-Prot: 100% identical to MFTF_MYCTU: Putative mycofactocin biosynthesis glycosyltransferase MftF (mftF) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10710)

MetaCyc: 73% identical to mycofactocin glucosyltransferase (Mycolicibacterium smegmatis)
2.4.1.M64 [EC: 2.4.1.M64]; 2.4.1.M64 [EC: 2.4.1.M64]; 2.4.1.M64 [EC: 2.4.1.M64]; 2.4.1.M64 [EC: 2.4.1.M64]; 2.4.1.M64 [EC: 2.4.1.M64]; 2.4.1.M64 [EC: 2.4.1.M64]; 2.4.1.M64 [EC: 2.4.1.M64]; 2.4.1.M64 [EC: 2.4.1.M64]; 2.4.1.M64 [EC: 2.4.1.M64]

Predicted SEED Role

"Mycofactocin system glycosyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.M64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>Rv0696 Probable membrane sugar transferase (Mycobacterium tuberculosis H37Rv)
MTATRLPDGFAVQVDRRVRVLGDGSALLGGSPTRLLRLAPAARGLLCDGRLKVRDEVSAE
LARILLDATVAHPRPPSGPSHRDVTVVIPVRNNASGLRRLVTSLRGLRVIVVDDGSACPV
ESDDFVGAHCDIEVLHHPHSKGPAAARNTGLAACTTDFVAFLDSDVTPRRGWLESLLGHF
CDPTVALVAPRIVSLVEGENPVARYEALHSSLDLGQREAPVLPHSTVSYVPSAAIVCRSS
AIRDVGGFDETMHSGEDVDLCWRLIEAGARLRYEPIALVAHDHRTQLRDWIARKAFYGGS
AAPLAVRHPDKTAPLVISGGALMAWILMSIGTGLGRLASLVIAVLTGRRIARAMRCAETS
FLDVLAVATRGLWAAALQLASAICRHYWPLALLAAILSRRCRRVVLIAAVVDGVVDWLRR
REGADDDAEPIGPLTYLVLKRVDDLAYGAGLWYGVVRERNIGALKPQIRT