Protein Info for Rv0695 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03964: mycofactocin system creatininase family protein
  • amino acids 15 to 250 (236 residues), 358.7 bits, E=6.3e-112
• PF02633: Creatininase
  • amino acids 25 to 238 (214 residues), 203.9 bits, E=1.4e-64

Best Hits

Swiss-Prot: 100% identical to MFTE_MYCTO: Putative mycofactocin system creatinine amidohydrolase family protein MftE (mftE) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10709)

MetaCyc: 77% identical to [mycofactocin precursor peptide] peptidase (Mycobacterium ulcerans)
RXN-21240 [EC: 3.4.14.14]

Predicted SEED Role

"Cyclic amid hydrolase in mycofactocin cluster"

MetaCyc Pathways

• mycofactocin biosynthesis (13/15 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.14.14

Protein Sequence (251 amino acids)

>Rv0695 Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
VNSSYHRRVPVVGELGSATSSQLPSTSPSIVIPLGSTEQHGPHLPLDTDTRIATAVARTV
TARLHAEDLPIAQEEWLMAPAIAYGASGEHQRFAGTISIGTEALTMLLVEYGRSAACWAR
RLVFVNGHGGNVGALTRAVGLLRAEGRDAGWCPCTCPGGDPHAGHTETSVLLHLSPADVR
TERWRAGNRAPLPVLLPSMRRGGVAAVSETGVLGDPTTATAAEGRRIFAAMVDDCVRRVA
RWMPQPDGMLT