Protein Info for Rv0693 in Mycobacterium tuberculosis H37Rv

Annotation: Probable coenzyme PQQ synthesis protein E PqqE (coenzyme PQQ synthesis protein III)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 TIGR03962: mycofactocin radical SAM maturase" amino acids 9 to 348 (340 residues), 681.9 bits, see alignment E=1.6e-209 PF04055: Radical_SAM" amino acids 25 to 180 (156 residues), 100.3 bits, see alignment E=1.4e-32 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 251 to 331 (81 residues), 49.4 bits, see alignment E=5e-17 PF13186: SPASM" amino acids 251 to 313 (63 residues), 29 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 100% identical to MFTC_MYCTO: Putative mycofactocin radical SAM maturase MftC (mftC) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_0742)

MetaCyc: 89% identical to mycofactocin tyrosine decarboxylase (Mycobacterium ulcerans)
RXN-21241 [EC: 4.1.99.26]; RXN-21239 [EC: 4.1.99.26, 1.3.98.7]

Predicted SEED Role

"Mycofactocin radical SAM maturase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.98.7 or 4.1.99.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>Rv0693 Probable coenzyme PQQ synthesis protein E PqqE (coenzyme PQQ synthesis protein III) (Mycobacterium tuberculosis H37Rv)
MTSPVPRLIEQFERGLDAPICLTWELTYACNLACVHCLSSSGKRDPGELSTRQCKDIIDE
LERMQVFYVNIGGGEPTVRPDFWELVDYATAHHVGVKFSTNGVRITPEVATRLAATDYVD
VQISLDGATAEVNDAIRGTGSFDMAVRALQNLAAAGFAGVKISVVITRRNVAQLDEFATL
ASRYGATLRITRLRPSGRGTDVWADLHPTADQQVQLYDWLVSKGERVLTGDSFFHLAPLG
QSGALAGLNMCGAGRVVCLIDPVGDVYACPFAIHDHFLAGNVLSDGGFQNVWKNSSLFRE
LREPQSAGACGSCGHYDSCRGGCMAAKFFTGLPLDGPDPECVQGHSEPALARERHLPRPR
ADHSRGRRVSKPVPLTLSMRPPKRPCNESPV