Protein Info for Rv0691c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR03968: mycofactocin system transcriptional regulator" amino acids 6 to 193 (188 residues), 295.1 bits, see alignment E=9.4e-93 PF00440: TetR_N" amino acids 19 to 60 (42 residues), 50.2 bits, see alignment 1.8e-17 PF17754: TetR_C_14" amino acids 85 to 193 (109 residues), 139.5 bits, see alignment E=4.2e-45

Best Hits

Swiss-Prot: 100% identical to MFTR_MYCTU: Putative mycofactocin biosynthesis transcriptional regulator MftR (mftR) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00704)

Predicted SEED Role

"Mycofactocin system transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>Rv0691c Probable transcriptional regulatory protein (Mycobacterium tuberculosis H37Rv)
MPHESRVGRRRSTTPHHISDVAIELFAAHGFTDVSVDDIARAAGIARRTLFRYYASKNAI
PWGDFSTHLAQLQGLLDNIDSRIQLRDALRAALLAFNTFDESETIRHRKRMRVILQTPEL
QAYSMTMYAGWREVIAKFVARRSGGKTTDFMPQTVAWTMLGVALSAYEHWLRDESVSLTE
ALGAAFDVVGAGLDRLNQ