Protein Info for Rv0688 in Mycobacterium tuberculosis H37Rv

Annotation: Putative ferredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF07992: Pyr_redox_2" amino acids 18 to 310 (293 residues), 222.2 bits, see alignment E=2.6e-69 PF00070: Pyr_redox" amino acids 156 to 236 (81 residues), 68.5 bits, see alignment E=1.5e-22 PF14759: Reductase_C" amino acids 330 to 398 (69 residues), 47 bits, see alignment E=7.7e-16

Best Hits

Swiss-Prot: 37% identical to RURE_PSEOL: Rubredoxin-NAD(+) reductase (alkT) from Pseudomonas oleovorans

KEGG orthology group: None (inferred from 100% identity to mtc:MT0716)

MetaCyc: 37% identical to rubredoxin-NAD(+) reductase (Pseudomonas oleovorans)
Rubredoxin--NAD(+) reductase. [EC: 1.18.1.1]; Alkane 1-monooxygenase. [EC: 1.18.1.1, 1.14.15.3]

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.15.3

Use Curated BLAST to search for 1.14.15.3 or 1.18.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>Rv0688 Putative ferredoxin reductase (Mycobacterium tuberculosis H37Rv)
MNAHVTSREGVNEFDDGIVIVGGGLAAARTAEQLRRAGYSGRLTIVSDEVHLPYDRPPLS
KEVLRSEVDDVALKPREFYDEKDIALRLGSAAVSLDTGEQTVTLADGTVLGYDELVIATG
LVPRRIPSLPDLDGIRVLRSFDESMALRKHASAARHAVVVGAGFIGCEVAASLRGLGVDV
VLVEPQPAPLASVLGEQIGQLVTRLHRDEGVDVRTGVTVAEVRGKGHVDAVVLTDGTELP
ADLVVVGIGSTPATEWLEGSGVEVDNGVICDKAGRTSAPNVWALGDVASWRDPMGHQARV
EHWSNVADQARVVVPAMLGTDVPTGVVVPYFWSDQYDVKIQCLGEPHATDVVHLVEDDGR
KFLAYYERDGVLVGVVGGGMAGKVMKVRGKIAAGAPIAEVLDQTQA