Protein Info for Rv0687 in Mycobacterium tuberculosis H37Rv

Annotation: Probable short-chain type dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR03971: SDR family mycofactocin-dependent oxidoreductase" amino acids 8 to 273 (266 residues), 360 bits, see alignment E=3.8e-112 PF00106: adh_short" amino acids 12 to 212 (201 residues), 158.3 bits, see alignment E=2.5e-50 PF08659: KR" amino acids 14 to 185 (172 residues), 59.4 bits, see alignment E=6.9e-20 PF13561: adh_short_C2" amino acids 17 to 271 (255 residues), 162.4 bits, see alignment E=2.1e-51

Best Hits

Swiss-Prot: 100% identical to Y0687_MYCTO: Uncharacterized NAD-dependent oxidoreductase MT0715 (MT0715) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00700)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>Rv0687 Probable short-chain type dehydrogenase/reductase (Mycobacterium tuberculosis H37Rv)
VSARGGSLHGRVAFVTGAARAQGRSHAVRLAREGADIVALDICAPVSGSVTYPPATSEDL
GETVRAVEAEGRKVLAREVDIRDDAELRRLVADGVEQFGRLDIVVANAGVLGWGRLWELT
DEQWETVIGVNLTGTWRTLRATVPAMIDAGNGGSIVVVSSSAGLKATPGNGHYAASKHAL
VALTNTLAIELGEFGIRVNSIHPYSVDTPMIEPEAMIQTFAKHPGYVHSFPPMPLQPKGF
MTPDEISDVVVWLAGDGSGALSGNQIPVDKGALKY