Protein Info for Rv0684 in Mycobacterium tuberculosis H37Rv

Annotation: Probable elongation factor G FusA1 (EF-G)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 TIGR00484: translation elongation factor G" amino acids 8 to 698 (691 residues), 1114.2 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 12 to 285 (274 residues), 218.4 bits, see alignment E=1.6e-68 TIGR00231: small GTP-binding protein domain" amino acids 14 to 183 (170 residues), 118.3 bits, see alignment E=2.8e-38 PF03144: GTP_EFTU_D2" amino acids 328 to 394 (67 residues), 60 bits, see alignment E=6.4e-20 PF14492: EFG_III" amino acids 408 to 482 (75 residues), 114.8 bits, see alignment E=3.6e-37 PF03764: EFG_IV" amino acids 483 to 604 (122 residues), 153.1 bits, see alignment E=7.3e-49 PF00679: EFG_C" amino acids 608 to 692 (85 residues), 103.7 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 100% identical to EFG_MYCBT: Elongation factor G (fusA) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to mbb:BCG_0733)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (701 amino acids)

>Rv0684 Probable elongation factor G FusA1 (EF-G) (Mycobacterium tuberculosis H37Rv)
VAQKDVLTDLSRVRNFGIMAHIDAGKTTTTERILYYTGINYKIGEVHDGAATMDWMEQEQ
ERGITITSAATTTFWKDNQLNIIDTPGHVDFTVEVERNLRVLDGAVAVFDGKEGVEPQSE
QVWRQADKYDVPRICFVNKMDKIGADFYFSVRTMGERLGANAVPIQLPVGAEADFEGVVD
LVEMNAKVWRGETKLGETYDTVEIPADLAEQAEEYRTKLLEVVAESDEHLLEKYLGGEEL
TVDEIKGAIRKLTIASEIYPVLCGSAFKNKGVQPMLDAVVDYLPSPLDVPPAIGHAPAKE
DEEVVRKATTDEPFAALAFKIATHPFFGKLTYIRVYSGTVESGSQVINATKGKKERLGKL
FQMHSNKENPVDRASAGHIYAVIGLKDTTTGDTLSDPNQQIVLESMTFPDPVIEVAIEPK
TKSDQEKLSLSIQKLAEEDPTFKVHLDSETGQTVIGGMGELHLDILVDRMRREFKVEANV
GKPQVAYKETIKRLVQNVEYTHKKQTGGSGQFAKVIINLEPFTGEEGATYEFESKVTGGR
IPREYIPSVDAGAQDAMQYGVLAGYPLVNLKVTLLDGAYHEVDSSEMAFKIAGSQVLKKA
AALAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERAGARVVRAHVPLSEMF
GYVGDLRSKTQGRANYSMVFDSYSEVPANVSKEIIAKATGE