Protein Info for Rv0673 in Mycobacterium tuberculosis H37Rv

Annotation: Possible enoyl-CoA hydratase EchA4 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF00378: ECH_1" amino acids 22 to 85 (64 residues), 39.4 bits, see alignment E=4.4e-14 amino acids 124 to 270 (147 residues), 65.8 bits, see alignment E=4e-22 PF16113: ECH_2" amino acids 25 to 234 (210 residues), 61.1 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to mtu:Rv0673)

Predicted SEED Role

"Enoyl-CoA hydratase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>Rv0673 Possible enoyl-CoA hydratase EchA4 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) (Mycobacterium tuberculosis H37Rv)
MTHAIRPVDFDNLKTMTYEVTGRIARITFNRPEKGNAIIADTPLELSALVERADLDPGVH
VILVSGRGEGFCAGFDLSAYAEGSSSTGGGGAYQGTVLDGKTQAVNHLPNQPWDPMIDYQ
MMSRFVRGFASLMHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPEPADLDERTERLVARIAALPV
NQLIMVKLALNSALLQQGVATSRMVSTVFDGAARHTPEGHAFVADAVEHGFRDAVRRRDE
PFGDYGRQASRV