Protein Info for Rv0670 in Mycobacterium tuberculosis H37Rv

Annotation: Probable endonuclease IV End (endodeoxyribonuclease IV) (apurinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF01261: AP_endonuc_2" amino acids 14 to 248 (235 residues), 148 bits, see alignment E=2.1e-47

Best Hits

Swiss-Prot: 100% identical to END4_MYCBP: Probable endonuclease 4 (nfo) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K01151, deoxyribonuclease IV [EC: 3.1.21.2] (inferred from 100% identity to mbt:JTY_0689)

Predicted SEED Role

"Endonuclease IV (EC 3.1.21.2)" in subsystem DNA repair, bacterial (EC 3.1.21.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>Rv0670 Probable endonuclease IV End (endodeoxyribonuclease IV) (apurinase) (Mycobacterium tuberculosis H37Rv)
VLIGSHVSPTDPLAAAEAEGADVVQIFLGNPQSWKAPKPRDDAAALKAATLPIYVHAPYL
INLASANNRVRIPSRKILQETCAAAADIGAAAVIVHGGHVADDNDIDKGFQRWRKALDRL
ETEVPVYLENTAGGDHAMARRFDTIARLWDVIGDTGIGFCLDTCHTWAAGEALTDAVDRI
KAITGRIDLVHCNDSRDEAGSGRDRHANLGSGQIDPDLLVAAVKAAGAPVICETADQGRK
DDIAFLRERTGS