Protein Info for Rv0639 in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcription antitermination protein NusG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF02357: NusG" amino acids 48 to 150 (103 residues), 94.4 bits, see alignment E=2.6e-31 TIGR00922: transcription termination/antitermination factor NusG" amino acids 49 to 238 (190 residues), 223.8 bits, see alignment E=6.2e-71

Best Hits

Swiss-Prot: 100% identical to NUSG_MYCBO: Transcription termination/antitermination protein NusG (nusG) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 100% identity to mtc:MT0668)

Predicted SEED Role

"Transcription antitermination protein NusG" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>Rv0639 Probable transcription antitermination protein NusG (Mycobacterium tuberculosis H37Rv)
VTTFDGDTSAGEAVDLTEANAFQDAAAPAEEVDPAAALKAELRSKPGDWYVVHSYAGYEN
KVKANLETRVQNLDVGDYIFQVEVPTEEVTEIKNGQRKQVNRKVLPGYILVRMDLTDDSW
AAVRNTPGVTGFVGATSRPSALALDDVVKFLLPRGSTRKAAKGAASTAAAAEAGGLERPV
VEVDYEVGESVTVMDGPFATLPATISEVNAEQQKLKVLVSIFGRETPVELTFGQVSKI