Protein Info for Rv0638 in Mycobacterium tuberculosis H37Rv

Annotation: Probable preprotein translocase SecE1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00964: preprotein translocase, SecE subunit
  • amino acids 106 to 161 (56 residues), 74.6 bits, E=2.2e-25
• PF00584: SecE
  • amino acids 107 to 160 (54 residues), 67.3 bits, E=4.3e-23

Best Hits

Swiss-Prot: 99% identical to SECE_MYCTO: Protein translocase subunit SecE (secE) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03073, preprotein translocase subunit SecE (inferred from 99% identity to mtf:TBFG_10651)

Predicted SEED Role

"Preprotein translocase subunit SecE (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Protein Sequence (161 amino acids)

>Rv0638 Probable preprotein translocase SecE1 (Mycobacterium tuberculosis H37Rv)
VSDEGDVADEAVADGAENADSRGSGGRTALVTKPVVRPQRPTGKRSRSRAAGADADVDVE
EPSTAASEATGVAKDDSTTKAVSKAARAKKASKPKARSVNPIAFVYNYLKQVVAEMRKVI
WPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG