Protein Info for Rv0634c in Mycobacterium tuberculosis H37Rv

Annotation: Possible glyoxalase II (hydroxyacylglutathione hydrolase) (GLX II)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00753: Lactamase_B
  • amino acids 29 to 203 (175 residues), 82.9 bits, E=1.5e-27

Best Hits

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 100% identity to mtb:TBMG_00643)

Predicted SEED Role

"FIG00822416: hypothetical protein"

MetaCyc Pathways

• methylglyoxal degradation I (1/3 steps found)
• methylglyoxal degradation VIII (1/3 steps found)
• superpathway of methylglyoxal degradation (3/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Protein Sequence (237 amino acids)

>Rv0634c Possible glyoxalase II (hydroxyacylglutathione hydrolase) (GLX II) (Mycobacterium tuberculosis H37Rv)
VSKDRLYFRQLLSGRDFAVGDMFATQMRNFAYLIGDRTTGDCVVVDPAYAAGDLLDALES
DDMQLSGVLVTHHHPDHVGGSMMGFQLPGLAELLERASVPVHVNTHEALWVSRVTGIPVG
DLITHEHGDKVSVGDIDIELLHTPGHTPGSQCFLLDGRLVAGDTLFLEGCGRTDFPGGDS
DEMYRSLRQLAELPGDPTVFPGHWYSAEPSASLSEVKRSNYVYRPASLDQWRMLMGG