Protein Info for Rv0619 in Mycobacterium tuberculosis H37Rv

Annotation: Probable galactose-1-phosphate uridylyltransferase GalTb [second part]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF02744: GalP_UDP_tr_C" amino acids 29 to 179 (151 residues), 55.1 bits, see alignment E=3.9e-19

Best Hits

KEGG orthology group: K00965, UDPglucose--hexose-1-phosphate uridylyltransferase [EC: 2.7.7.12] (inferred from 100% identity to mtu:Rv0619)

Predicted SEED Role

"Galactose-1-phosphate uridylyltransferase (EC 2.7.7.10)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.7.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.10, 2.7.7.12

Use Curated BLAST to search for 2.7.7.10 or 2.7.7.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>Rv0619 Probable galactose-1-phosphate uridylyltransferase GalTb [second part] (Mycobacterium tuberculosis H37Rv)
GDRGDPAHPHGQIYAYPYLTPRTAAMLRQARRHRKRHGDNLFASLLAREVADGSRIVVRG
ELFTAFVPFAARWPVEVHIYPNRLVRNLTELNDGELDEFARIYLDVLQRFDRMYSSPLPY
MSALHQFSEVQRDGYFHVELMSIRRSATKLKYLAAAESAMDAFIADVIPESVATRLRELG
P