Protein Info for Rv0592 in Mycobacterium tuberculosis H37Rv

Annotation: Mce-family protein Mce2D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 38 (19 residues), see Phobius details TIGR00996: virulence factor Mce family protein" amino acids 15 to 312 (298 residues), 325.1 bits, see alignment E=1.9e-101 PF02470: MlaD" amino acids 46 to 121 (76 residues), 54.3 bits, see alignment E=1.3e-18 PF11887: Mce4_CUP1" amino acids 128 to 291 (164 residues), 40.8 bits, see alignment E=2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtc:MT0622)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>Rv0592 Mce-family protein Mce2D (Mycobacterium tuberculosis H37Rv)
MSTIFDIRSLRLPKLSAKVVVVGGLVVVLAVVAAAAGARLYRKLTTTTVVAYFSEALALY
PGDKVQIMGVRVGSIDKIEPAGDKMRVTLHYSNKYQVPATATASILNPSLVASRTIQLSP
PYTGGPVLQDGAVIPIERTQVPVEWDQLRDSINGILRQLGPTERQPKGPFGDLIESAADN
LAGKGRQLNETLNSLSQALTALNEGRGDFVAITRSLALFVSALYQNDQQFVALNENLAEF
TDWFTKSDHDLADTVERIDDVLGTVRKFVSDNRSVLAADVNNLADATTTLVQPEPRDGLE
TALHVLPTYASNFNNLYYPLHSSLVGQFVFPNFANPIQLICSAIQAGSRLGYQESAELCA
QYLAPVLDALKFNYLPFGSNPFSSAATLPKEVAYSEERLRPPPGYKDTTVPGIFSRDTPF
SHGNHEPGWVVAPGMQGMQVQPFTANMLTPESLAELLGGPDIAPPPPGTNLPGPPNAYDE
SNPLPPPWYPQPASLPAAGATGQPGPGQ