Protein Info for Rv0591 in Mycobacterium tuberculosis H37Rv

Annotation: Mce-family protein Mce2C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR00996: virulence factor Mce family protein" amino acids 11 to 292 (282 residues), 281.8 bits, see alignment E=2.9e-88 PF02470: MlaD" amino acids 39 to 112 (74 residues), 49.3 bits, see alignment E=4.8e-17 PF11887: Mce4_CUP1" amino acids 117 to 300 (184 residues), 41.3 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 100% identity to mtb:TBMG_00599)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>Rv0591 Mce-family protein Mce2C (Mycobacterium tuberculosis H37Rv)
MRTLTEFNRGRVGMMGAVVTVLVVGVAQSFTSVPMLFATPTYYAQFADTGGINTGDKVEI
AGVNVGLVRSLAIRGNRVLIGFSLPGKTIGMQSRAAIRTDTILGRKNLEIEPRGSEPLKP
NGFLPLAQTTTPYQIYDAFVDVTKAATGWDIDAVKRSLNVLSETFDQTAPHLSAALEGVK
AFSDTVGRRGEQIEQLLANANRIARVLGDRSEQVNGLLVNAKTLLAAFKQRSQALRILLT
NVSEASAQVSGLITDNPNLNHVLAQLRTVSEELVKRKNELADVAVLLGRYTAALTEAVGS
GPFFKAMVVNLLPYQILQPWVDAAFKKRGIDPENFWRSAGLPEFRWPDPNGTRFPNGAPP
AAPPVREGTPKHPGPAVPPGTPCSYTPAAGALPRPDTPLPCAGATVGPFGGPDFPAPLDV
QPSPPNPDGPPPTPGILSAGRPGEPAPAVPGIPMPLPPNAPPGARTQPLEPFPDGTGGSN
Q