Protein Info for Rv0590 in Mycobacterium tuberculosis H37Rv

Annotation: Mce-family protein Mce2B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR00996: virulence factor Mce family protein" amino acids 9 to 256 (248 residues), 223.2 bits, see alignment E=2e-70 PF02470: MlaD" amino acids 38 to 110 (73 residues), 62.6 bits, see alignment E=3.5e-21 PF11887: Mce4_CUP1" amino acids 115 to 256 (142 residues), 108.5 bits, see alignment E=3.8e-35

Best Hits

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 100% identity to mtc:MT0619)

Predicted SEED Role

"MCE-family protein Mce1B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>Rv0590 Mce-family protein Mce2B (Mycobacterium tuberculosis H37Rv)
MKTTGTTIKLGIVWLVLSVFTVMIIVVFGQVRFHHTTGYSAVFTHVSGLRAGQFVRAAGV
EVGKVAKVTLIDGDKQVLVDFTVDRSLSLDQATTASIRYLNLIGDRYLELGRGHSGQRLA
PGATIPLEHTHPALDLDALLGGFRPLFQTLDPDKVNSIASSIITVFQGQGATINDILDQT
ASLTATLADRDHAIGEVVNNLNTVLATTVKHQTEFDRTVDKLEVLITGLKNRADPLAAAA
AHISSAAGTLADLLGRIVHCCTAASGTSRASSSRS