Protein Info for Rv0585c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 795 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 145 to 162 (18 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 493 to 516 (24 residues), see Phobius details amino acids 525 to 549 (25 residues), see Phobius details amino acids 605 to 625 (21 residues), see Phobius details amino acids 637 to 656 (20 residues), see Phobius details amino acids 688 to 709 (22 residues), see Phobius details amino acids 715 to 735 (21 residues), see Phobius details amino acids 742 to 762 (21 residues), see Phobius details amino acids 768 to 789 (22 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 498 to 782 (285 residues), 95.3 bits, see alignment E=2.5e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00592)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (795 amino acids)

>Rv0585c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MRVDGRDIGVSGNLLQPLTRRTNDIIRAVLAAIYLVAVITSSLITRPQWVALEKSISEIV
GVLSPSQSDLVYLGYGLAILALPFVILIGLIVSRQWKLLGAYAAAGLMAVLPLSISSSRI
AAPRWHFDLSDRLATLLAQFLDDPRWIAMLAAVLTVSGPWLPARWRHWWWALLLAFVPIH
LVVSAIVPARSLLGLAVGWLVGALVVLVVGTPALEVPLDGAIRALAKRGFAVSGLAVVRP
AGPGPLVLSAACEQPNAGACSEALIELYGPHQSGGGALRQLWLKLTLRGTETAPLQASMR
RAVEHRALMAIAFGDLGMANTTVIAVSPLDRGWTLYAHRPARGIGISECTKTTPTAHVWE
ALRTLHDQQISHGDLCSAEITVDNGAVLFGGFGEAEYGATDAQLQSDLAQLLVTTSALYD
AEAAVTAAIDTFGKQAILAASRRLTKSAVPKRIRESITDPNAVIASTRAEVMRQTGADQI
KAETITRFSRGQLIQLVLIGALVYVAYPFISTVPTFFSQLRTANWWWALLGLAVSALTYV
GAAAALWACADGLVGFWKLSIMQVANTFAATTTPAGVGGLALSTRFLQKGGLTAVRATAA
VALQQSVQVIVHLVLLILFSALAGTSTDLSHFVPNATVLYLIAGVALGIVGTFLFVPKLR
RWLATAVRPKLREVTNDLIALAREPKRLALIVLGCAGTTLGAALALWASIEAFGGGTTFV
TVTVVTMVGGTLASAAPTPGGVGAVEAALIGGLAAFGVPAALGVPSVLLYRLLTCWLPVF
AGWQVMHWLTRHEMI