Protein Info for Rv0568 in Mycobacterium tuberculosis H37Rv

Annotation: Possible cytochrome P450 135B1 Cyp135B1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 PF00067: p450" amino acids 10 to 432 (423 residues), 205.5 bits, see alignment E=7.3e-65

Best Hits

Swiss-Prot: 100% identical to C135B_MYCBO: Putative cytochrome P450 135B1 (cyp135B1) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00517, [EC: 1.14.-.-] (inferred from 100% identity to mbt:JTY_0583)

Predicted SEED Role

"Putative cytochrome P450 135B1 (EC 1.14.-.-)" (EC 1.14.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.-.-

Use Curated BLAST to search for 1.14.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>Rv0568 Possible cytochrome P450 135B1 Cyp135B1 (Mycobacterium tuberculosis H37Rv)
MSGTSSMGLPPGPRLSGSVQAVLMLRHGLRFLTACQRRYGSVFTLHVAGFGHMVYLSDPA
AIKTVFAGNPSVFHAGEANSMLAGLLGDSSLLLIDDDVHRDRRRLMSPPFHRDAVARQAG
PIAEIAAANIAGWPMAKAFAVAPKMSEITLEVILRTVIGASDPVRLAALRKVMPRLLNVG
PWATLALANPSLLNNRLWSRLRRRIEEADALLYAEIADRRADPDLAARTDTLAMLVRAAD
EDGRTMTERELRDQLITLLVAGHDTTATGLSWALERLTRHPVTLAKAVQAADASAAGDPA
GDEYLDAVAKETLRIRPVVYDVGRVLTEAVEVAGYRLPAGVMVVPAIGLVHASAQLYPDP
ERFDPDRMVGATLSPTTWLPFGGGNRRCLGATFAMVEMRVVLREILRRVELSTTTTSGER
PKLKHVIMVPHRGARIRVRATRDVSATSQATAQGAGCPAARGGGPSRAVGSQ