Protein Info for Rv0567 in Mycobacterium tuberculosis H37Rv

Annotation: Probable methyltransferase/methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16864: Dimerisation2
  • amino acids 8 to 92 (85 residues), 48.4 bits, E=2.6e-16
• PF00891: Methyltransf_2
  • amino acids 111 to 321 (211 residues), 139 bits, E=5e-44
• PF13489: Methyltransf_23
  • amino acids 157 to 321 (165 residues), 29.2 bits, E=2.5e-10
• PF05175: MTS
  • amino acids 161 to 275 (115 residues), 31.2 bits, E=5.9e-11
• PF13649: Methyltransf_25
  • amino acids 176 to 270 (95 residues), 31.1 bits, E=1.1e-10
• PF08241: Methyltransf_11
  • amino acids 177 to 274 (98 residues), 27.2 bits, E=1.8e-09
• PF08242: Methyltransf_12
  • amino acids 177 to 271 (95 residues), 33.4 bits, E=2.2e-11

Best Hits

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 99% identity to mbb:BCG_0612)

Predicted SEED Role

"O-methyltransferase"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (339 amino acids)

>Rv0567 Probable methyltransferase/methylase (Mycobacterium tuberculosis H37Rv)
VELSPDRIMAIGGGYGPSKVLLTAVGLGLFTELGDEAMTAEAIADRLGLLKRPAIDFLDA
LVSLDLLARDGDGPGSHYRNTPETAHFLDEARPTYAGGLLKIWNERNYRFWADLTEALKT
GKAQSEVKQTGRPFFEALYADPRRLEAFMAAMDAASRRNIELLAKRFPFERYRRLCDVGC
ADGLLSRIVAAAHPHLQCVSFDLPAVTEIARRKLTAEGLGERVQACAGDFLADPLPAADV
ITMGQILHDWNLDRKQQLVAKAYEALSKEGAFIVIETLIDDARRENTTGLMMSLNMLIEF
GDAFDYSAADFRGWCGEAGFRSFEVIPLAGGSSAAVAYK