Protein Info for Rv0564c in Mycobacterium tuberculosis H37Rv

Annotation: Probable glycerol-3-phosphate dehydrogenase [NAD(P)+] GpdA1 (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase) (NAD(P)H-dependent dihydroxyacetone-phosphate reductase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03807: F420_oxidored" amino acids 9 to 111 (103 residues), 22.1 bits, see alignment E=3.8e-08 PF01210: NAD_Gly3P_dh_N" amino acids 9 to 164 (156 residues), 165.4 bits, see alignment E=2.2e-52 PF07479: NAD_Gly3P_dh_C" amino acids 184 to 323 (140 residues), 169.5 bits, see alignment E=1e-53 PF20618: GPD_NAD_C_bact" amino acids 244 to 310 (67 residues), 72.5 bits, see alignment E=6.8e-24

Best Hits

Swiss-Prot: 100% identical to GPDA2_MYCTO: Probable glycerol-3-phosphate dehydrogenase 2 [NAD(P)+] (gpsA2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 100% identity to mbb:BCG_0609c)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.94

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>Rv0564c Probable glycerol-3-phosphate dehydrogenase [NAD(P)+] GpdA1 (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase) (NAD(P)H-dependent dihydroxyacetone-phosphate reductase) (Mycobacterium tuberculosis H37Rv)
MAANKREPKVVVLGGGSWGTTVASICARRGPTLQWVRSAVTAQDINDNHRNSRYLGNDVV
LSDTLRATTDFTEAANCADVVVMGVPSHGFRGVLVELSKELRPWVPVVSLVKGLEQGTNM
RMSQIIEEVLPGHPAGILAGPNIAREVAEGYAAAAVLAMPDQHLATRLSAMFRTRRFRVY
TTDDVVGVETAGALKNVFAIAVGMGYSLGIGENTRALVIARALREMTKLGVAMGGKSETF
PGLAGLGDLIVTCTSQRSRNRHVGEQLGAGKPIDEIIASMSQVAEGVKAAGVVMEFANEF
GLNMPIAREVDAVINHGSTVEQAYRGLIAEVPGHEVHGSGF