Protein Info for Rv0563 in Mycobacterium tuberculosis H37Rv

Annotation: Probable protease transmembrane protein heat shock protein HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 51 (17 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details PF01435: Peptidase_M48" amino acids 70 to 283 (214 residues), 127.1 bits, see alignment E=3.7e-41

Best Hits

Swiss-Prot: 100% identical to HTPX_MYCTO: Protease HtpX homolog (htpX) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 100% identity to mtc:MT0589)

Predicted SEED Role

"Probable protease htpX homolog (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>Rv0563 Probable protease transmembrane protein heat shock protein HtpX (Mycobacterium tuberculosis H37Rv)
MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGMNVYVYFNSDKLALRA
MHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFATGRNPRNAAVCCTTGI
LRILNERELRAVLGHELSHVYNRDILISCVAGALAAVITALANMAMWAGMFGGNRDNANP
FALLLVALLGPIAATVIRMAVSRSREYQADESGAVLTGDPLALASALRKISGGVQAAPLP
PEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLEAMARG