Protein Info for Rv0561c in Mycobacterium tuberculosis H37Rv

Annotation: Possible oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF01494: FAD_binding_3" amino acids 7 to 181 (175 residues), 57 bits, see alignment E=9.9e-19 PF01134: GIDA" amino acids 8 to 36 (29 residues), 22.4 bits, see alignment (E = 3e-08) TIGR02032: geranylgeranyl reductase family" amino acids 8 to 316 (309 residues), 237.3 bits, see alignment E=1.5e-74 PF12831: FAD_oxidored" amino acids 8 to 145 (138 residues), 32.1 bits, see alignment E=3.9e-11 PF00890: FAD_binding_2" amino acids 8 to 37 (30 residues), 23.5 bits, see alignment (E = 1.5e-08) PF07992: Pyr_redox_2" amino acids 8 to 162 (155 residues), 40.2 bits, see alignment E=1.4e-13 PF05834: Lycopene_cycl" amino acids 8 to 300 (293 residues), 34.2 bits, see alignment E=8e-12 PF13450: NAD_binding_8" amino acids 11 to 39 (29 residues), 24.3 bits, see alignment (E = 1.6e-08)

Best Hits

Swiss-Prot: 100% identical to MENJ_MYCTU: Menaquinone reductase (menJ) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mra:MRA_0568)

MetaCyc: 100% identical to menaquinone-9 beta-reductase (Mycobacterium tuberculosis H37Rv)
RXN-16868 [EC: 1.3.99.38]

Predicted SEED Role

"Possible oxidoreductase (EC 1.-.-.-)" (EC 1.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.3.99.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>Rv0561c Possible oxidoreductase (Mycobacterium tuberculosis H37Rv)
VSVDDSADVVVVGAGPAGSAAAAWAARAGRDVLVIDTATFPRDKPCGDGLTPRAVAELHQ
LGLGKWLADHIRHRGLRMSGFGGEVEVDWPGPSFPSYGSAVARLELDDRIRKVAEDTGAR
MLLGAKAVAVHHDSSRRVVSLTLADGTEVGCRQLIVADGARSPLGRKLGRRWHRETVYGV
AVRGYLSTAYSDDPWLTSHLELRSPDGAVLPGYGWIFPLGNGEVNIGVGALSTSRRPADL
ALRPLISYYTDLRRDEWGFTGQPRAVSSALLPMGGAVSGVAGSNWMLIGDAAACVNPLNG
EGIDYGLETGRLAAELLDSRDLARLWPSLLADRYGRGFSVARRLALLLTFPRFLPTTGPI
TMRSTALMNIAVRVMSNLVTDDDRDWVARVWRGGGQLSRLVDRRPPFS