Protein Info for Rv0558 in Mycobacterium tuberculosis H37Rv

Annotation: Probable ubiquinone/menaquinone biosynthesis methyltransferase MenH (2-heptaprenyl-1,4-naphthoquinone methyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 11 to 227 (217 residues), 198.6 bits, E=3.1e-62
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 13 to 227 (215 residues), 245.3 bits, E=2.3e-77
• PF13489: Methyltransf_23
  • amino acids 38 to 167 (130 residues), 31.6 bits, E=4e-11
• PF13847: Methyltransf_31
  • amino acids 51 to 196 (146 residues), 39.3 bits, E=1.6e-13
• PF13649: Methyltransf_25
  • amino acids 55 to 141 (87 residues), 54 bits, E=6.7e-18
• PF08241: Methyltransf_11
  • amino acids 56 to 145 (90 residues), 64.2 bits, E=4.3e-21

Best Hits

Swiss-Prot: 100% identical to MENG_MYCTO: Demethylmenaquinone methyltransferase (menG) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 100% identity to mbb:BCG_0603)

Predicted SEED Role

"2-heptaprenyl-1,4-naphthoquinone methyltransferase MenG (EC 2.1.1.163)" (EC 2.1.1.163)

MetaCyc Pathways

• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-10 biosynthesis (8/10 steps found)
• superpathway of menaquinol-11 biosynthesis (8/10 steps found)
• superpathway of menaquinol-12 biosynthesis (8/10 steps found)
• superpathway of menaquinol-13 biosynthesis (8/10 steps found)
• superpathway of menaquinol-6 biosynthesis (8/10 steps found)
• superpathway of menaquinol-8 biosynthesis I (8/10 steps found)
• superpathway of menaquinol-9 biosynthesis (8/10 steps found)
• menaquinol-10 biosynthesis (2/2 steps found)
• menaquinol-11 biosynthesis (2/2 steps found)
• menaquinol-12 biosynthesis (2/2 steps found)
• menaquinol-13 biosynthesis (2/2 steps found)
• menaquinol-7 biosynthesis (2/2 steps found)
• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• superpathway of chorismate metabolism (40/59 steps found)
• superpathway of menaquinol-8 biosynthesis III (1/9 steps found)
• superpathway of menaquinol-8 biosynthesis II (1/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Protein Sequence (234 amino acids)

>Rv0558 Probable ubiquinone/menaquinone biosynthesis methyltransferase MenH (2-heptaprenyl-1,4-naphthoquinone methyltransferase) (Mycobacterium tuberculosis H37Rv)
MSRAALDKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAA
GTAVSTVELTKSGAWCVAADFSVGMLAAGAARKVPKVAGDATRLPFGDDVFDAVTISFGL
RNVANQQAALREMARVTRPGGRLLVCEFSTPTNALFATAYKEYLMRALPRVARAVSSNPE
AYEYLAESIRAWPDQAVLAHQISRAGWSGVRWRNLTGGIVALHAGYKPGKQTPQ