Protein Info for Rv0554 in Mycobacterium tuberculosis H37Rv

Annotation: Possible peroxidase BpoC (non-haem peroxidase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 14 to 246 (233 residues), 88.8 bits, E=9.2e-29
• PF12697: Abhydrolase_6
  • amino acids 15 to 250 (236 residues), 89 bits, E=1.5e-28
• PF12146: Hydrolase_4
  • amino acids 21 to 244 (224 residues), 42.6 bits, E=9.1e-15
• PF08386: Abhydrolase_4
  • amino acids 197 to 259 (63 residues), 30.8 bits, E=5.5e-11

Best Hits

Swiss-Prot: 100% identical to BPOC_MYCTU: Putative non-heme bromoperoxidase BpoC (bpoC) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00435, peroxiredoxin [EC: 1.11.1.-] (inferred from 100% identity to mbb:BCG_0599)

Predicted SEED Role

"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)

MetaCyc Pathways

• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (6/7 steps found)
• superpathway of menaquinol-10 biosynthesis (8/10 steps found)
• superpathway of menaquinol-11 biosynthesis (8/10 steps found)
• superpathway of menaquinol-12 biosynthesis (8/10 steps found)
• superpathway of menaquinol-13 biosynthesis (8/10 steps found)
• superpathway of menaquinol-6 biosynthesis (8/10 steps found)
• superpathway of menaquinol-8 biosynthesis I (8/10 steps found)
• superpathway of menaquinol-9 biosynthesis (8/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (7/9 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (7/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (7/9 steps found)
• superpathway of chorismate metabolism (40/59 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.-

Use Curated BLAST to search for 1.11.1.- or 4.2.99.20

Protein Sequence (262 amino acids)

>Rv0554 Possible peroxidase BpoC (non-haem peroxidase) (Mycobacterium tuberculosis H37Rv)
VINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGF
TTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRAR
QFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGL
RCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHL
GFFERPEAVNTAMLKFFASVKA