Protein Info for Rv0554 in Mycobacterium tuberculosis H37Rv
Annotation: Possible peroxidase BpoC (non-haem peroxidase)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to BPOC_MYCTU: Putative non-heme bromoperoxidase BpoC (bpoC) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K00435, peroxiredoxin [EC: 1.11.1.-] (inferred from 100% identity to mbb:BCG_0599)Predicted SEED Role
"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)
MetaCyc Pathways
- superpathway of menaquinol-7 biosynthesis (9/10 steps found)
- 2-carboxy-1,4-naphthoquinol biosynthesis (6/7 steps found)
- superpathway of menaquinol-10 biosynthesis (8/10 steps found)
- superpathway of menaquinol-11 biosynthesis (8/10 steps found)
- superpathway of menaquinol-12 biosynthesis (8/10 steps found)
- superpathway of menaquinol-13 biosynthesis (8/10 steps found)
- superpathway of menaquinol-6 biosynthesis (8/10 steps found)
- superpathway of menaquinol-8 biosynthesis I (8/10 steps found)
- superpathway of menaquinol-9 biosynthesis (8/10 steps found)
- superpathway of demethylmenaquinol-6 biosynthesis I (7/9 steps found)
- superpathway of demethylmenaquinol-8 biosynthesis I (7/9 steps found)
- superpathway of demethylmenaquinol-9 biosynthesis (7/9 steps found)
- superpathway of chorismate metabolism (40/59 steps found)
- superpathway of phylloquinol biosynthesis (7/15 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.11.1.-
Use Curated BLAST to search for 1.11.1.- or 4.2.99.20
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (262 amino acids)
>Rv0554 Possible peroxidase BpoC (non-haem peroxidase) (Mycobacterium tuberculosis H37Rv) VINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGF TTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRAR QFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGL RCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHL GFFERPEAVNTAMLKFFASVKA