Protein Info for Rv0550c in Mycobacterium tuberculosis H37Rv

Annotation: Possible antitoxin VapB3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 88 PF07362: CcdA" amino acids 19 to 61 (43 residues), 28.2 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 99% identical to VAPB3_MYCTU: Antitoxin VapB3 (vapB3) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to mtb:TBMG_03989)

Predicted SEED Role

"Antitoxin 1a"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (88 amino acids)

>Rv0550c Possible antitoxin VapB3 (Mycobacterium tuberculosis H37Rv)
LLSRRTKTIVVCTLVCMARLNVYVPDELAERARARGLNVSALTQAAISAELENSATDAWL
EGLEPRSTGARHDDVLGAIDAARDEFEA